Class b: All beta proteins [48724] (176 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.7: SET domain [82199] (4 families) duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII also contains a substrate-binding alpha+beta subdomain inserted in the core |
Family b.85.7.0: automated matches [227191] (1 protein) not a true family |
Protein automated matches [226914] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225158] (11 PDB entries) |
Domain d3fpda_: 3fpd A: [210038] automated match to d1pega_ complexed with q4a, sah, zn |
PDB Entry: 3fpd (more details), 2.4 Å
SCOPe Domain Sequences for d3fpda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fpda_ b.85.7.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} verivsrdiargyeripipcvnavdsepcpsnykyvsqncvtspmnidrnithlqycvci ddcsssncmcgqlsmrcwydkdgrllpefnmaepplifecnhacscwrncrnrvvqnglr arlqlyrtrdmgwgvrslqdippgtfvceyvgelisdseadvreedsylfdldnkdgevy cidarfygnvsrfinhhcepnlvpvrvfmahqdlrfpriaffstrlieageqlgfdyger fwdikgklfscrcgspkcrhs
Timeline for d3fpda_: