SCOPe 2.06: Domain d3fo2l2: 3fo2 L:113-216

Lineage for d3fo2l2 (3fo2 L:113-216)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries)

8. Domain d3fo2l2: 3fo2 L:113-216 [210025]
   Other proteins in same PDB: d3fo2a1, d3fo2l1
   automated match to d1blna2
   complexed with bzh; mutant

Details for d3fo2l2

PDB Entry: 3fo2, 2.18 Å

PDB Description: crystal structure of hapten complex of catalytic elimination antibody 13g5 (glu(l39)gln mutant)

PDB Compounds: (L:) Catalytic antibody Fab 13G5 kappa light chain chimera

SCOPe Domain Sequences for d3fo2l2:

Sequence; same for both SEQRES and ATOM records:

>d3fo2l2 b.1.1.0 (L:113-216) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d3fo2l2:

• d3fo2l2 first appeared in SCOPe 2.03
  
• d3fo2l2 appears in SCOPe 2.05
  
• d3fo2l2 appears in SCOPe 2.07
  
• d3fo2l2 appears in the current release, SCOPe 2.08