Lineage for d6fabl2 (6fab L:109-214)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 786045Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (5 species)
  7. 786271Species Mouse (Mus musculus) [TaxId:10090] [88567] (318 PDB entries)
    Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity
    SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region)
    Uniprot P01837 # KAC_MOUSE Ig kappa chain C region
    Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region
    SQ NA # part of Fab 28 against HIV-1 RT
    Uniprot P01837 #
    KAC_MOUSE Ig kappa chain C region
    Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region
  8. 786386Domain d6fabl2: 6fab L:109-214 [21002]
    Other proteins in same PDB: d6fabh1, d6fabh2, d6fabl1
    part of Fab 36-71

Details for d6fabl2

PDB Entry: 6fab (more details), 1.9 Å

PDB Description: three-dimensional structure of murine anti-p-azophenylarsonate fab 36-71. 1. x-ray crystallography, site-directed mutagenesis, and modeling of the complex with hapten
PDB Compounds: (L:) igg1-kappa 36-71 fab (light chain)

SCOP Domain Sequences for d6fabl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fabl2 b.1.1.2 (L:109-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d6fabl2:

Click to download the PDB-style file with coordinates for d6fabl2.
(The format of our PDB-style files is described here.)

Timeline for d6fabl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6fabl1