Lineage for d3fmxx_ (3fmx X:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1619978Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 1619979Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 1620301Family c.77.1.0: automated matches [191423] (1 protein)
    not a true family
  6. 1620302Protein automated matches [190603] (13 species)
    not a true protein
  7. 1620346Species Pseudomonas putida [TaxId:303] [225791] (2 PDB entries)
  8. 1620351Domain d3fmxx_: 3fmx X: [210011]
    automated match to d3udua_
    complexed with nai, nh4

Details for d3fmxx_

PDB Entry: 3fmx (more details), 2.95 Å

PDB Description: crystal structure of tartrate dehydrogenase from pseudomonas putida complexed with nadh
PDB Compounds: (X:) Tartrate dehydrogenase/decarboxylase

SCOPe Domain Sequences for d3fmxx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fmxx_ c.77.1.0 (X:) automated matches {Pseudomonas putida [TaxId: 303]}
sfriaaipgdgiglevlpegirvleaaalkhglalefdtfewascdyylqhgkmmpddwa
eqlkqydaiyfgavgwpdkvpdhislwgsllkfrrefdqyvnirpvrlfpgvpcalanrk
vgdidfvvvrentegeysslggimfenteneiviqesiftrrgvdrilkyafdlaekrer
khvtsatksngmaismpywdkrteamaahyphvswdkqhidilcarfvlqperfdvvvas
nlfgdilsdlgpacagtigiapsanlnpernfpslfepvhgsapdifgknianpiamiws
galmleflgqgderyqrahddmlnaierviadgsvtpdmggtlstqqvgaaisdtlarl

SCOPe Domain Coordinates for d3fmxx_:

Click to download the PDB-style file with coordinates for d3fmxx_.
(The format of our PDB-style files is described here.)

Timeline for d3fmxx_: