Lineage for d4fabh2 (4fab H:119-216)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655348Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)
  8. 655728Domain d4fabh2: 4fab H:119-216 [21001]
    Other proteins in same PDB: d4fabh1, d4fabl1, d4fabl2
    part of Fab 4-4-20
    complexed with fds, mpd

Details for d4fabh2

PDB Entry: 4fab (more details), 2.7 Å

PDB Description: three-dimensional structure of a fluorescein-fab complex crystallized in 2-methyl-2,4-pentanediol
PDB Compounds: (H:) igg2a-kappa 4-4-20 fab (heavy chain)

SCOP Domain Sequences for d4fabh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fabh2 b.1.1.2 (H:119-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkie

SCOP Domain Coordinates for d4fabh2:

Click to download the PDB-style file with coordinates for d4fabh2.
(The format of our PDB-style files is described here.)

Timeline for d4fabh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4fabh1