![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
![]() | Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88576] (237 PDB entries) |
![]() | Domain d4fabh2: 4fab H:119-216 [21001] Other proteins in same PDB: d4fabh1, d4fabl1, d4fabl2 part of Fab 4-4-20 complexed with fds, mpd |
PDB Entry: 4fab (more details), 2.7 Å
SCOP Domain Sequences for d4fabh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fabh2 b.1.1.2 (H:119-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)} akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd lytlsssvtvtsstwpsqsitcnvahpasstkvdkkie
Timeline for d4fabh2: