SCOPe 2.08: Domain d3flva1: 3flv A:5-94

Lineage for d3flva1 (3flv A:5-94)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
   core: 3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.11.1: Acyl-CoA binding protein [47027] (2 families)

5. Family a.11.1.0: automated matches [191596] (1 protein)
   not a true family

6. Protein automated matches [191086] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189032] (2 PDB entries)

8. Domain d3flva1: 3flv A:5-94 [210009]
   Other proteins in same PDB: d3flva2, d3flvb2
   automated match to d2wh5a_
   complexed with coa, ste, unx

Details for d3flva1

PDB Entry: 3flv, 1.7 Å

PDB Description: the crystal structure of human acyl-coenzymea binding domain containing 5

PDB Compounds: (A:) Acyl-CoA-binding domain-containing protein 5

SCOPe Domain Sequences for d3flva1:

Sequence; same for both SEQRES and ATOM records:

>d3flva1 a.11.1.0 (A:5-94) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hetrfeaavkviqslpkngsfqptnemmlkfysfykqategpcklsrpgfwdpigrykwd
awsslgdmtkeeamiayveemkkiietmpm

Timeline for d3flva1:

• d3flva1 first appeared in SCOPe 2.03, called d3flva_
  
• d3flva1 appears in SCOPe 2.07