Lineage for d3flva1 (3flv A:5-94)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697426Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2697427Superfamily a.11.1: Acyl-CoA binding protein [47027] (2 families) (S)
  5. 2697448Family a.11.1.0: automated matches [191596] (1 protein)
    not a true family
  6. 2697449Protein automated matches [191086] (6 species)
    not a true protein
  7. 2697454Species Human (Homo sapiens) [TaxId:9606] [189032] (2 PDB entries)
  8. 2697455Domain d3flva1: 3flv A:5-94 [210009]
    Other proteins in same PDB: d3flva2, d3flvb2
    automated match to d2wh5a_
    complexed with coa, ste, unx

Details for d3flva1

PDB Entry: 3flv (more details), 1.7 Å

PDB Description: the crystal structure of human acyl-coenzymea binding domain containing 5
PDB Compounds: (A:) Acyl-CoA-binding domain-containing protein 5

SCOPe Domain Sequences for d3flva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3flva1 a.11.1.0 (A:5-94) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hetrfeaavkviqslpkngsfqptnemmlkfysfykqategpcklsrpgfwdpigrykwd
awsslgdmtkeeamiayveemkkiietmpm

SCOPe Domain Coordinates for d3flva1:

Click to download the PDB-style file with coordinates for d3flva1.
(The format of our PDB-style files is described here.)

Timeline for d3flva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3flva2