Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily) consists of two intertwined (sub)domains related by pseudo dyad; duplication 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest |
Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) the constituent families form similar dimers |
Family c.77.1.0: automated matches [191423] (1 protein) not a true family |
Protein automated matches [190603] (13 species) not a true protein |
Species Pseudomonas putida [TaxId:303] [225791] (2 PDB entries) |
Domain d3flkb_: 3flk B: [210006] automated match to d3udua_ complexed with dtt, mg, nad, nh4, oxl, so4 |
PDB Entry: 3flk (more details), 2 Å
SCOPe Domain Sequences for d3flkb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3flkb_ c.77.1.0 (B:) automated matches {Pseudomonas putida [TaxId: 303]} sfriaaipgdgiglevlpegirvleaaalkhglalefdtfewascdyylqhgkmmpddwa eqlkqydaiyfgavgwpdkvpdhislwgsllkfrrefdqyvnirpvrlfpgvpcalanrk vgdidfvvvrentegeysslggimfenteneiviqesiftrrgvdrilkyafdlaekrer khvtsatksngmaismpywdkrteamaahyphvswdkqhidilcarfvlqperfdvvvas nlfgdilsdlgpacagtigiapsanlnpernfpslfepvhgsapdifgknianpiamiws galmleflgqgderyqrahddmlnaierviadgsvtpdmggtlstqqvgaaisdtlarl
Timeline for d3flkb_: