SCOPe 2.08: Domain d3flka_: 3flk A:

Lineage for d3flka_ (3flk A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families)
   the constituent families form similar dimers

5. Family c.77.1.0: automated matches [191423] (1 protein)
   not a true family

6. Protein automated matches [190603] (25 species)
   not a true protein

7. Species Pseudomonas putida [TaxId:303] [225791] (2 PDB entries)

8. Domain d3flka_: 3flk A: [210005]
   automated match to d3udua_
   complexed with dtt, mg, nai, nh4, oxl, so4

Details for d3flka_

PDB Entry: 3flk, 2 Å

PDB Description: crystal structure of tartrate dehydrogenase from pseudomonas putida in complex with nadh, oxalate and metal ion

PDB Compounds: (A:) Tartrate dehydrogenase/decarboxylase

SCOPe Domain Sequences for d3flka_:

Sequence; same for both SEQRES and ATOM records:

>d3flka_ c.77.1.0 (A:) automated matches {Pseudomonas putida [TaxId: 303]}
sfriaaipgdgiglevlpegirvleaaalkhglalefdtfewascdyylqhgkmmpddwa
eqlkqydaiyfgavgwpdkvpdhislwgsllkfrrefdqyvnirpvrlfpgvpcalanrk
vgdidfvvvrentegeysslggimfenteneiviqesiftrrgvdrilkyafdlaekrer
khvtsatksngmaismpywdkrteamaahyphvswdkqhidilcarfvlqperfdvvvas
nlfgdilsdlgpacagtigiapsanlnpernfpslfepvhgsapdifgknianpiamiws
galmleflgqgderyqrahddmlnaierviadgsvtpdmggtlstqqvgaaisdtlarl

Timeline for d3flka_:

• d3flka_ first appeared in SCOPe 2.03
  
• d3flka_ appears in SCOPe 2.07