Lineage for d3flka_ (3flk A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905791Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2905792Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2906251Family c.77.1.0: automated matches [191423] (1 protein)
    not a true family
  6. 2906252Protein automated matches [190603] (25 species)
    not a true protein
  7. 2906387Species Pseudomonas putida [TaxId:303] [225791] (2 PDB entries)
  8. 2906388Domain d3flka_: 3flk A: [210005]
    automated match to d3udua_
    complexed with dtt, mg, nai, nh4, oxl, so4

Details for d3flka_

PDB Entry: 3flk (more details), 2 Å

PDB Description: crystal structure of tartrate dehydrogenase from pseudomonas putida in complex with nadh, oxalate and metal ion
PDB Compounds: (A:) Tartrate dehydrogenase/decarboxylase

SCOPe Domain Sequences for d3flka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3flka_ c.77.1.0 (A:) automated matches {Pseudomonas putida [TaxId: 303]}
sfriaaipgdgiglevlpegirvleaaalkhglalefdtfewascdyylqhgkmmpddwa
eqlkqydaiyfgavgwpdkvpdhislwgsllkfrrefdqyvnirpvrlfpgvpcalanrk
vgdidfvvvrentegeysslggimfenteneiviqesiftrrgvdrilkyafdlaekrer
khvtsatksngmaismpywdkrteamaahyphvswdkqhidilcarfvlqperfdvvvas
nlfgdilsdlgpacagtigiapsanlnpernfpslfepvhgsapdifgknianpiamiws
galmleflgqgderyqrahddmlnaierviadgsvtpdmggtlstqqvgaaisdtlarl

SCOPe Domain Coordinates for d3flka_:

Click to download the PDB-style file with coordinates for d3flka_.
(The format of our PDB-style files is described here.)

Timeline for d3flka_: