SCOP 1.63: Domain d4fabl2: 4fab L:113-219

Lineage for d4fabl2 (4fab L:113-219)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Fab 4-4-20 (mouse), kappa L chain [48999] (2 PDB entries)

8. Domain d4fabl2: 4fab L:113-219 [21000]
   Other proteins in same PDB: d4fabh1, d4fabl1

Details for d4fabl2

PDB Entry: 4fab, 2.7 Å

PDB Description: three-dimensional structure of a fluorescein-fab complex crystallized in 2-methyl-2,4-pentanediol

SCOP Domain Sequences for d4fabl2:

Sequence; same for both SEQRES and ATOM records:

>d4fabl2 b.1.1.2 (L:113-219) Immunoglobulin (constant domains of L and H chains) {Fab 4-4-20 (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d4fabl2:

• d4fabl2 first appeared (with stable ids) in SCOP 1.55
  
• d4fabl2 appears in SCOP 1.61
  
• d4fabl2 appears in SCOP 1.65
  
• d4fabl2 appears in the current release, SCOPe 2.08