Lineage for d3fkra_ (3fkr A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2096922Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2098336Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2098337Protein automated matches [190115] (75 species)
    not a true protein
  7. 2098419Species Azospirillum brasilense [TaxId:192] [225809] (2 PDB entries)
  8. 2098420Domain d3fkra_: 3fkr A: [209999]
    automated match to d3dz1a_
    complexed with na, po4

Details for d3fkra_

PDB Entry: 3fkr (more details), 1.8 Å

PDB Description: structure of l-2-keto-3-deoxyarabonate dehydratase complex with pyruvate
PDB Compounds: (A:) L-2-keto-3-deoxyarabonate dehydratase

SCOPe Domain Sequences for d3fkra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fkra_ c.1.10.0 (A:) automated matches {Azospirillum brasilense [TaxId: 192]}
tprhrgifpvvpttfadtgdldlasqkravdfmidagsdglcilanfseqfaitdderdv
ltrtilehvagrvpvivttshystqvcaarslraqqlgaamvmamppyhgatfrvpeaqi
fefyarvsdaiaipimvqdapasgtalsapflarmareieqvayfxietpgaanklreli
rlggdaiegpwdgeeaitlladlhagatgamtgggfpdgirpileawregrhddayaryq
awlplinhenrqsgiltakalmreggviaserprhpmpelhpdtraellaiarrldplvl
rwah

SCOPe Domain Coordinates for d3fkra_:

Click to download the PDB-style file with coordinates for d3fkra_.
(The format of our PDB-style files is described here.)

Timeline for d3fkra_: