Lineage for d3fk7b2 (3fk7 B:68-205)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1279958Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 1279959Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 1279960Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 1280146Protein Tetracyclin repressor (Tet-repressor, TetR) [48500] (1 species)
  7. 1280147Species Escherichia coli [TaxId:562] [48501] (25 PDB entries)
  8. 1280162Domain d3fk7b2: 3fk7 B:68-205 [209992]
    Other proteins in same PDB: d3fk7a1, d3fk7b1
    automated match to d1qpia2
    protein/DNA complex; complexed with 4dm, mg; mutant

Details for d3fk7b2

PDB Entry: 3fk7 (more details), 2.06 Å

PDB Description: crystal structure of tetr triple mutant (h64k, s135l, s138i) in complex with 4-ddma-atc
PDB Compounds: (B:) tetracycline repressor protein class b from transposon tn10, tetracycline repressor protein class d

SCOPe Domain Sequences for d3fk7b2:

Sequence, based on SEQRES records: (download)

>d3fk7b2 a.121.1.1 (B:68-205) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyailavihftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl
hgleslirgfevqltall

Sequence, based on observed residues (ATOM records): (download)

>d3fk7b2 a.121.1.1 (B:68-205) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyailavihftlgavleqqehtaaltdrpnlppllrealqimdsddgeqaflhgles
lirgfevqltall

SCOPe Domain Coordinates for d3fk7b2:

Click to download the PDB-style file with coordinates for d3fk7b2.
(The format of our PDB-style files is described here.)

Timeline for d3fk7b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fk7b1