SCOPe 2.06: Domain d3fk7a1: 3fk7 A:4-67

Lineage for d3fk7a1 (3fk7 A:4-67)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)

6. Protein Tetracyclin repressor (Tet-repressor, TetR) [46765] (1 species)

7. Species Escherichia coli [TaxId:562] [46766] (27 PDB entries)

8. Domain d3fk7a1: 3fk7 A:4-67 [209989]
   Other proteins in same PDB: d3fk7a2, d3fk7b2
   automated match to d1qpia1
   protein/DNA complex; complexed with 4dm, mg; mutant

Details for d3fk7a1

PDB Entry: 3fk7, 2.06 Å

PDB Description: crystal structure of tetr triple mutant (h64k, s135l, s138i) in complex with 4-ddma-atc

PDB Compounds: (A:) tetracycline repressor protein class b from transposon tn10, tetracycline repressor protein class d

SCOPe Domain Sequences for d3fk7a1:

Sequence; same for both SEQRES and ATOM records:

>d3fk7a1 a.4.1.9 (A:4-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
ldkskvinsalellnevgieglttrklaqklgveqptlywhvknkralldalaveilarh
kdys

Timeline for d3fk7a1:

• d3fk7a1 first appeared in SCOPe 2.03
  
• d3fk7a1 appears in SCOPe 2.05
  
• d3fk7a1 appears in SCOPe 2.07
  
• d3fk7a1 appears in the current release, SCOPe 2.08