Lineage for d3fk6b2 (3fk6 B:68-204)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2727850Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2727851Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2727852Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2728122Protein Tetracyclin repressor (Tet-repressor, TetR) [48500] (1 species)
  7. 2728123Species Escherichia coli [TaxId:562] [48501] (37 PDB entries)
  8. 2728146Domain d3fk6b2: 3fk6 B:68-204 [209988]
    Other proteins in same PDB: d3fk6a1, d3fk6b1
    automated match to d1qpia2
    mutant

Details for d3fk6b2

PDB Entry: 3fk6 (more details), 2.1 Å

PDB Description: crystal structure of tetr triple mutant (h64k, s135l, s138i)
PDB Compounds: (B:) tetracycline repressor protein class b from transposon tn10, tetracycline repressor protein class d

SCOPe Domain Sequences for d3fk6b2:

Sequence, based on SEQRES records: (download)

>d3fk6b2 a.121.1.1 (B:68-204) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyailavihftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl
hgleslirgfevqltal

Sequence, based on observed residues (ATOM records): (download)

>d3fk6b2 a.121.1.1 (B:68-204) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyailavihftlgavleqqehtaalenlppllrealqimdsddgeqaflhgleslir
gfevqltal

SCOPe Domain Coordinates for d3fk6b2:

Click to download the PDB-style file with coordinates for d3fk6b2.
(The format of our PDB-style files is described here.)

Timeline for d3fk6b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fk6b1