![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (20 families) ![]() consists only of helices |
![]() | Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) |
![]() | Protein Tetracyclin repressor (Tet-repressor, TetR) [46765] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [46766] (36 PDB entries) |
![]() | Domain d3fk6b1: 3fk6 B:3-67 [209987] Other proteins in same PDB: d3fk6a2, d3fk6b2 automated match to d1qpia1 mutant |
PDB Entry: 3fk6 (more details), 2.1 Å
SCOPe Domain Sequences for d3fk6b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fk6b1 a.4.1.9 (B:3-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]} rldkskvinsalellnevgieglttrklaqklgveqptlywhvknkralldalaveilar hkdys
Timeline for d3fk6b1: