SCOPe 2.08: Domain d3fk6b1: 3fk6 B:3-67

Lineage for d3fk6b1 (3fk6 B:3-67)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)

6. Protein Tetracyclin repressor (Tet-repressor, TetR) [46765] (1 species)

7. Species Escherichia coli [TaxId:562] [46766] (36 PDB entries)

8. Domain d3fk6b1: 3fk6 B:3-67 [209987]
   Other proteins in same PDB: d3fk6a2, d3fk6b2
   automated match to d1qpia1
   mutant

Details for d3fk6b1

PDB Entry: 3fk6, 2.1 Å

PDB Description: crystal structure of tetr triple mutant (h64k, s135l, s138i)

PDB Compounds: (B:) tetracycline repressor protein class b from transposon tn10, tetracycline repressor protein class d

SCOPe Domain Sequences for d3fk6b1:

Sequence; same for both SEQRES and ATOM records:

>d3fk6b1 a.4.1.9 (B:3-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
rldkskvinsalellnevgieglttrklaqklgveqptlywhvknkralldalaveilar
hkdys

Timeline for d3fk6b1:

• d3fk6b1 first appeared in SCOPe 2.03
  
• d3fk6b1 appears in SCOPe 2.07