SCOPe 2.08: Domain d3fk6a2: 3fk6 A:68-207

Lineage for d3fk6a2 (3fk6 A:68-207)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)

6. Protein Tetracyclin repressor (Tet-repressor, TetR) [48500] (1 species)

7. Species Escherichia coli [TaxId:562] [48501] (37 PDB entries)

8. Domain d3fk6a2: 3fk6 A:68-207 [209986]
   Other proteins in same PDB: d3fk6a1, d3fk6b1
   automated match to d1qpia2
   mutant

Details for d3fk6a2

PDB Entry: 3fk6, 2.1 Å

PDB Description: crystal structure of tetr triple mutant (h64k, s135l, s138i)

PDB Compounds: (A:) tetracycline repressor protein class b from transposon tn10, tetracycline repressor protein class d

SCOPe Domain Sequences for d3fk6a2:

Sequence, based on SEQRES records:

>d3fk6a2 a.121.1.1 (A:68-207) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyailavihftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl
hgleslirgfevqltallqi

Sequence, based on observed residues (ATOM records):

>d3fk6a2 a.121.1.1 (A:68-207) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyailavihftlgavleqqehtaalnlppllrealqimdsddgeqaflhgleslirg
fevqltallqi

Timeline for d3fk6a2:

• d3fk6a2 first appeared in SCOPe 2.03
  
• d3fk6a2 appears in SCOPe 2.07