SCOPe 2.07: Domain d3fjtb1: 3fjt B:236-339

Lineage for d3fjtb1 (3fjt B:236-339)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d3fjtb1: 3fjt B:236-339 [209983]
   automated match to d2ql1a1
   complexed with bma, fuc, man, nag

Details for d3fjtb1

PDB Entry: 3fjt, 2.5 Å

PDB Description: crystal structure of a human fc fragment engineered for extended serum half-life

PDB Compounds: (B:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d3fjtb1:

Sequence; same for both SEQRES and ATOM records:

>d3fjtb1 b.1.1.2 (B:236-339) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ggpsvflfppkpkdtlyitrepevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska

Timeline for d3fjtb1:

• d3fjtb1 first appeared in SCOPe 2.03
  
• d3fjtb1 appears in SCOPe 2.06
  
• d3fjtb1 appears in the current release, SCOPe 2.08