Lineage for d3fjta2 (3fjt A:340-444)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762660Protein automated matches [190374] (14 species)
    not a true protein
  7. 1762816Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)
  8. 1763245Domain d3fjta2: 3fjt A:340-444 [209982]
    automated match to d2ql1a2

Details for d3fjta2

PDB Entry: 3fjt (more details), 2.5 Å

PDB Description: crystal structure of a human fc fragment engineered for extended serum half-life
PDB Compounds: (A:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d3fjta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fjta2 b.1.1.2 (A:340-444) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kgqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvld
sdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsls

SCOPe Domain Coordinates for d3fjta2:

Click to download the PDB-style file with coordinates for d3fjta2.
(The format of our PDB-style files is described here.)

Timeline for d3fjta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fjta1