Lineage for d3fjkd_ (3fjk D:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1543030Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1543031Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 1543032Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)
  6. 1543033Protein Acidic FGF (FGF1) [50357] (4 species)
  7. 1543047Species Human (Homo sapiens) [TaxId:9606] [50359] (84 PDB entries)
    Uniprot P05230 16-152 ! Uniprot P05230
  8. 1543179Domain d3fjkd_: 3fjk D: [209980]
    automated match to d1q03a_
    complexed with fmt, so4; mutant

Details for d3fjkd_

PDB Entry: 3fjk (more details), 2.15 Å

PDB Description: crystal structure of a66c mutant of human acidic fibroblast growth factor
PDB Compounds: (D:) heparin-binding growth factor 1

SCOPe Domain Sequences for d3fjkd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fjkd_ b.42.1.1 (D:) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
hhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyi
kstetgqylcmdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngs
ckrgprthygqkailflplpv

SCOPe Domain Coordinates for d3fjkd_:

Click to download the PDB-style file with coordinates for d3fjkd_.
(The format of our PDB-style files is described here.)

Timeline for d3fjkd_: