Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species) |
Species Fab TE33 (mouse), kappa L chain [48998] (1 PDB entry) |
Domain d1tetl2: 1tet L:108-211 [20996] Other proteins in same PDB: d1teth1, d1tetl1 |
PDB Entry: 1tet (more details), 2.3 Å
SCOP Domain Sequences for d1tetl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tetl2 b.1.1.2 (L:108-211) Immunoglobulin (constant domains of L and H chains) {Fab TE33 (mouse), kappa L chain} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyewhnsytceathktstspivksfnr
Timeline for d1tetl2: