SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3fj5a1 (3fj5 A:85-140)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2045654Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2045783Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2046226Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2046227Protein automated matches [190457] (9 species)
    not a true protein
  7. 2046257Species Chicken (Gallus gallus) [TaxId:9031] [225620] (14 PDB entries)
  8. 2046268Domain d3fj5a1: 3fj5 A:85-140 [209951]
    Other proteins in same PDB: d3fj5a2, d3fj5b2
    automated match to d1ynza_
    complexed with act, gol, pg4, pge, so4

Details for d3fj5a1

PDB Entry: 3fj5 (more details), 1.65 Å

PDB Description: Crystal structure of the c-src-SH3 domain
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d3fj5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fj5a1 b.34.2.0 (A:85-140) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
tfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgrtgyipsnyvaps

SCOPe Domain Coordinates for d3fj5a1:

Click to download the PDB-style file with coordinates for d3fj5a1.
(The format of our PDB-style files is described here.)

Timeline for d3fj5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fj5a2