Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species) |
Species Fab BV04-01 (mouse), kappa L chain [48997] (2 PDB entries) |
Domain d1cbvh2: 1cbv H:123-219 [20995] Other proteins in same PDB: d1cbvh1, d1cbvl1 |
PDB Entry: 1cbv (more details), 2.66 Å
SCOP Domain Sequences for d1cbvh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cbvh2 b.1.1.2 (H:123-219) Immunoglobulin (constant domains of L and H chains) {Fab BV04-01 (mouse), kappa L chain} kttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsgl ytmsssvtvpsstwpsqtvtcsvahpassttvdkkle
Timeline for d1cbvh2: