SCOPe 2.08: Domain d3fj4b1: 3fj4 B:4-132

Lineage for d3fj4b1 (3fj4 B:4-132)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (95 species)
   not a true protein

7. Species Pseudomonas fluorescens [TaxId:220664] [225446] (3 PDB entries)

8. Domain d3fj4b1: 3fj4 B:4-132 [209949]
   Other proteins in same PDB: d3fj4a2, d3fj4b2
   automated match to d1f9ca2
   complexed with mg, muc

Details for d3fj4b1

PDB Entry: 3fj4, 1.8 Å

PDB Description: crystal structure of muconate lactonizing enzyme from pseudomonas fluorescens complexed with muconolactone

PDB Compounds: (B:) Muconate cycloisomerase

SCOPe Domain Sequences for d3fj4b1:

Sequence; same for both SEQRES and ATOM records:

>d3fj4b1 d.54.1.0 (B:4-132) automated matches {Pseudomonas fluorescens [TaxId: 220664]}
hasaiesietiivdlptirphklamhtmqnqtlvlirlrcadgieglgesttigglaygn
espdsiktnidrfvaplligqdasninaamlrleqsirgntfaksgiesalldaqgkrlg
lpvsellgg

Timeline for d3fj4b1:

• d3fj4b1 first appeared in SCOPe 2.03
  
• d3fj4b1 appears in SCOPe 2.07