Lineage for d3fj1b_ (3fj1 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2157470Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2157471Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2157676Family c.80.1.0: automated matches [191405] (1 protein)
    not a true family
  6. 2157677Protein automated matches [190547] (15 species)
    not a true protein
  7. 2157774Species Silicibacter pomeroyi [TaxId:246200] [225589] (1 PDB entry)
  8. 2157776Domain d3fj1b_: 3fj1 B: [209945]
    Other proteins in same PDB: d3fj1a2
    automated match to d1mosa_
    complexed with cl, edo

Details for d3fj1b_

PDB Entry: 3fj1 (more details), 1.75 Å

PDB Description: crystal structure of putative phosphosugar isomerase (yp_167080.1) from silicibacter pomeroyi dss-3 at 1.75 a resolution
PDB Compounds: (B:) putative phosphosugar isomerase

SCOPe Domain Sequences for d3fj1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fj1b_ c.80.1.0 (B:) automated matches {Silicibacter pomeroyi [TaxId: 246200]}
hitrmrreideipeavqrlldhgaqdvarvaavlrlrdpsfvatvargssdhvctylsya
aelllglpvaslgpsvasvydarlrldralclavsqsgkspdivamtrnagrdgalcval
tndaasplagvsahtidihagpelsvaatktfvtsavaglmlladwaeddglraalgnlp
etlaaasridwpemrvaigarpslftlgrgtslavsneaalkfketcqlhaesyssaevl
hgpvsiveegfpvlgfaagdaaeaplaeiadqiaakgatvfattgrvtrarvlehvrsgh
altdplslivsfysmveafasergidpd

SCOPe Domain Coordinates for d3fj1b_:

Click to download the PDB-style file with coordinates for d3fj1b_.
(The format of our PDB-style files is described here.)

Timeline for d3fj1b_: