Lineage for d3fj1a_ (3fj1 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1387552Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 1387553Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 1387727Family c.80.1.0: automated matches [191405] (1 protein)
    not a true family
  6. 1387728Protein automated matches [190547] (13 species)
    not a true protein
  7. 1387806Species Silicibacter pomeroyi [TaxId:246200] [225589] (1 PDB entry)
  8. 1387807Domain d3fj1a_: 3fj1 A: [209944]
    automated match to d1mosa_
    complexed with cl, edo

Details for d3fj1a_

PDB Entry: 3fj1 (more details), 1.75 Å

PDB Description: crystal structure of putative phosphosugar isomerase (yp_167080.1) from silicibacter pomeroyi dss-3 at 1.75 a resolution
PDB Compounds: (A:) putative phosphosugar isomerase

SCOPe Domain Sequences for d3fj1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fj1a_ c.80.1.0 (A:) automated matches {Silicibacter pomeroyi [TaxId: 246200]}
gmtqhitrmrreideipeavqrlldhgaqdvarvaavlrlrdpsfvatvargssdhvcty
lsyaaelllglpvaslgpsvasvydarlrldralclavsqsgkspdivamtrnagrdgal
cvaltndaasplagvsahtidihagpelsvaatktfvtsavaglmlladwaeddglraal
gnlpetlaaasridwpemrvaigarpslftlgrgtslavsneaalkfketcqlhaesyss
aevlhgpvsiveegfpvlgfaagdaaeaplaeiadqiaakgatvfattgrvtrarvlehv
rsghaltdplslivsfysmveafasergidpd

SCOPe Domain Coordinates for d3fj1a_:

Click to download the PDB-style file with coordinates for d3fj1a_.
(The format of our PDB-style files is described here.)

Timeline for d3fj1a_: