Lineage for d3fixb_ (3fix B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1921278Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1921279Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1921812Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 1921813Protein automated matches [190038] (32 species)
    not a true protein
  7. 1922001Species Thermoplasma acidophilum [TaxId:2303] [225555] (4 PDB entries)
  8. 1922007Domain d3fixb_: 3fix B: [209941]
    automated match to d1tiqa_
    complexed with edo

Details for d3fixb_

PDB Entry: 3fix (more details), 2.3 Å

PDB Description: crystal structure of a putative n-acetyltransferase (ta0374) from thermoplasma acidophilum
PDB Compounds: (B:) n-acetyltransferase

SCOPe Domain Sequences for d3fixb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fixb_ d.108.1.0 (B:) automated matches {Thermoplasma acidophilum [TaxId: 2303]}
ieirklsiedletlievareswkwtyagiyseeyieswirekyskekllneivrsqsnld
ilflgafadstligfielkiiankaellrlylkpeythkkigktllleaekimkkkgile
crlyvhrqnsvgfsfyykngfkvedtdgsdfimekky

SCOPe Domain Coordinates for d3fixb_:

Click to download the PDB-style file with coordinates for d3fixb_.
(The format of our PDB-style files is described here.)

Timeline for d3fixb_: