SCOP 1.63: Domain d1cbvl2: 1cbv L:113-219

Lineage for d1cbvl2 (1cbv L:113-219)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Fab BV04-01 (mouse), kappa L chain [48997] (2 PDB entries)

8. Domain d1cbvl2: 1cbv L:113-219 [20994]
   Other proteins in same PDB: d1cbvh1, d1cbvl1

Details for d1cbvl2

PDB Entry: 1cbv, 2.66 Å

PDB Description: an autoantibody to single-stranded dna: comparison of the three- dimensional structures of the unliganded fab and a deoxynucleotide- fab complex

SCOP Domain Sequences for d1cbvl2:

Sequence; same for both SEQRES and ATOM records:

>d1cbvl2 b.1.1.2 (L:113-219) Immunoglobulin (constant domains of L and H chains) {Fab BV04-01 (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d1cbvl2:

• d1cbvl2 first appeared (with stable ids) in SCOP 1.55
  
• d1cbvl2 appears in SCOP 1.61
  
• d1cbvl2 appears in SCOP 1.65
  
• d1cbvl2 appears in the current release, SCOPe 2.08