Lineage for d3fi9a2 (3fi9 A:148-327)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2232528Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2232529Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2233134Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 2233135Protein automated matches [226850] (29 species)
    not a true protein
  7. 2233264Species Porphyromonas gingivalis [TaxId:431947] [225577] (1 PDB entry)
  8. 2233265Domain d3fi9a2: 3fi9 A:148-327 [209937]
    Other proteins in same PDB: d3fi9a1, d3fi9a3, d3fi9b1, d3fi9b3
    automated match to d1hyea2

Details for d3fi9a2

PDB Entry: 3fi9 (more details), 1.9 Å

PDB Description: crystal structure of malate dehydrogenase from porphyromonas gingivalis
PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d3fi9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fi9a2 d.162.1.0 (A:148-327) automated matches {Porphyromonas gingivalis [TaxId: 431947]}
lagldstrlqselakhfgikqslvtntrtygghgeqmavfastakvngtpltdligtdkl
tneqwaelkqrvvkgganiiklrgrssfqspsyvsiemiraamggeafrwpagcyvnvpg
fehimmamettitkdgvkhsdinqlgneaeraalkesyshlaklrdeviamgiipaiadw

SCOPe Domain Coordinates for d3fi9a2:

Click to download the PDB-style file with coordinates for d3fi9a2.
(The format of our PDB-style files is described here.)

Timeline for d3fi9a2: