Lineage for d3fi9a1 (3fi9 A:2-147)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2095614Species Porphyromonas gingivalis [TaxId:431947] [225576] (1 PDB entry)
  8. 2095615Domain d3fi9a1: 3fi9 A:2-147 [209936]
    Other proteins in same PDB: d3fi9a2, d3fi9a3, d3fi9b2, d3fi9b3
    automated match to d1hyea1

Details for d3fi9a1

PDB Entry: 3fi9 (more details), 1.9 Å

PDB Description: crystal structure of malate dehydrogenase from porphyromonas gingivalis
PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d3fi9a1:

Sequence, based on SEQRES records: (download)

>d3fi9a1 c.2.1.0 (A:2-147) automated matches {Porphyromonas gingivalis [TaxId: 431947]}
sylteekltivgaagmigsnmaqtaammrltpnlclydpfavglegvaeeirhcgfegln
ltftsdikealtdakyivssggaprkegmtredllkgnaeiaaqlgkdiksycpdckhvi
iifnpaditglvtliysglkpsqvtt

Sequence, based on observed residues (ATOM records): (download)

>d3fi9a1 c.2.1.0 (A:2-147) automated matches {Porphyromonas gingivalis [TaxId: 431947]}
sylteekltivgaagmigsnmaqtaammrltpnlclydpfavglegvaeeirhcgfegln
ltftsdikealtdakyivssggtredllkgnaeiaaqlgkdiksycpdckhviiifnpad
itglvtliysglkpsqvtt

SCOPe Domain Coordinates for d3fi9a1:

Click to download the PDB-style file with coordinates for d3fi9a1.
(The format of our PDB-style files is described here.)

Timeline for d3fi9a1: