SCOP 1.61: Domain d1nbvl2: 1nbv L:113-219

Lineage for d1nbvl2 (1nbv L:113-219)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)

7. Species Fab BV04-01 (mouse), kappa L chain [48997] (2 PDB entries)

8. Domain d1nbvl2: 1nbv L:113-219 [20992]
   Other proteins in same PDB: d1nbvh1, d1nbvl1

Details for d1nbvl2

PDB Entry: 1nbv, 2 Å

PDB Description: an autoantibody to single-stranded dna: comparison of the three- dimensional structures of the unliganded fab and a deoxynucleotide- fab complex

SCOP Domain Sequences for d1nbvl2:

Sequence; same for both SEQRES and ATOM records:

>d1nbvl2 b.1.1.2 (L:113-219) Immunoglobulin (constant domains of L and H chains) {Fab BV04-01 (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d1nbvl2:

• d1nbvl2 first appeared (with stable ids) in SCOP 1.55
  
• d1nbvl2 appears in SCOP 1.59
  
• d1nbvl2 appears in SCOP 1.63
  
• d1nbvl2 appears in the current release, SCOPe 2.08