| Class b: All beta proteins [48724] (180 folds) |
| Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily) duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain |
Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) ![]() |
| Family b.98.1.1: Zn aminopeptidase N-terminal domain [63738] (4 proteins) |
| Protein Leukotriene A4 hydrolase N-terminal domain [63739] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [63740] (58 PDB entries) Uniprot P09960 |
| Domain d3fh8a1: 3fh8 A:4-208 [209918] Other proteins in same PDB: d3fh8a2, d3fh8a3 automated match to d1hs6a2 complexed with 27p, act, imd, yb, zn |
PDB Entry: 3fh8 (more details), 1.67 Å
SCOPe Domain Sequences for d3fh8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fh8a1 b.98.1.1 (A:4-208) Leukotriene A4 hydrolase N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
vdtcslaspasvcrtkhlhlrcsvdftrrtltgtaaltvqsqednlrslvldtkdltiek
vvingqevkyalgerqsykgspmeislpialsknqeivieisfetspkssalqwltpeqt
sgkehpylfsqcqaihcrailpcqdtpsvkltytaevsvpkelvalmsairdgetpdped
psrkiykfiqkvpipcylialvvga
Timeline for d3fh8a1: