Lineage for d3fh8a1 (3fh8 A:4-208)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2409030Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
    duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain
  4. 2409031Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) (S)
  5. 2409032Family b.98.1.1: Zn aminopeptidase N-terminal domain [63738] (4 proteins)
  6. 2409048Protein Leukotriene A4 hydrolase N-terminal domain [63739] (1 species)
  7. 2409049Species Human (Homo sapiens) [TaxId:9606] [63740] (56 PDB entries)
    Uniprot P09960
  8. 2409053Domain d3fh8a1: 3fh8 A:4-208 [209918]
    Other proteins in same PDB: d3fh8a2, d3fh8a3
    automated match to d1hs6a2
    complexed with 27p, act, imd, yb, zn

Details for d3fh8a1

PDB Entry: 3fh8 (more details), 1.67 Å

PDB Description: Leukotriene A4 Hydrolase complexed with inhibitor 1-[2-(4-benzylphenoxy)ethyl]pyrrolidine.
PDB Compounds: (A:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d3fh8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fh8a1 b.98.1.1 (A:4-208) Leukotriene A4 hydrolase N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
vdtcslaspasvcrtkhlhlrcsvdftrrtltgtaaltvqsqednlrslvldtkdltiek
vvingqevkyalgerqsykgspmeislpialsknqeivieisfetspkssalqwltpeqt
sgkehpylfsqcqaihcrailpcqdtpsvkltytaevsvpkelvalmsairdgetpdped
psrkiykfiqkvpipcylialvvga

SCOPe Domain Coordinates for d3fh8a1:

Click to download the PDB-style file with coordinates for d3fh8a1.
(The format of our PDB-style files is described here.)

Timeline for d3fh8a1: