Lineage for d3fgua1 (3fgu A:5-218)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1857401Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1858517Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1858518Protein automated matches [226839] (49 species)
    not a true protein
  7. 1858644Species Human (Homo sapiens) [TaxId:9606] [224896] (42 PDB entries)
  8. 1858687Domain d3fgua1: 3fgu A:5-218 [209910]
    automated match to d1bdga1
    complexed with anp, bgc, k, mg

Details for d3fgua1

PDB Entry: 3fgu (more details), 2.15 Å

PDB Description: catalytic complex of human glucokinase
PDB Compounds: (A:) Glucokinase

SCOPe Domain Sequences for d3fgua1:

Sequence, based on SEQRES records: (download)

>d3fgua1 c.55.1.0 (A:5-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlyfqgmkkekveqilaefqlqeedlkkvmrrmqkemdrglrletheeasvkmlptyvrs
tpegsevgdflsldlggtnfrvmlvkvgegeegqwsvktkhqmysipedamtgtaemlfd
yisecisdfldkhqmkhkklplgftfsfpvrhedidkgillnwtkgfkasgaegnnvvgl
lrdaikrrgdfemdvvamvndtvatmiscyyedh

Sequence, based on observed residues (ATOM records): (download)

>d3fgua1 c.55.1.0 (A:5-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlyfqgmkkekveqilaefqlqeedlkkvmrrmqkemdrglrletheeasvkmlptyvrs
tpsevgdflsldlggtnfrvmlvkvgegqwsvktkhqmysipedamtgtaemlfdyisec
isdfldkhqmkklplgftfsfpvrhedidkgillnwtkgfkasgaegnnvvgllrdaikr
rgdfemdvvamvndtvatmiscyyedh

SCOPe Domain Coordinates for d3fgua1:

Click to download the PDB-style file with coordinates for d3fgua1.
(The format of our PDB-style files is described here.)

Timeline for d3fgua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fgua2