Lineage for d3fgob2 (3fgo B:125-239)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2817328Superfamily b.82.7: Metal cation-transporting ATPase, actuator domain A [81653] (1 family) (S)
    a distorted variant of double-helix
  5. 2817329Family b.82.7.1: Metal cation-transporting ATPase, actuator domain A [81652] (2 proteins)
  6. 2817330Protein Calcium ATPase, transduction domain A [81651] (1 species)
  7. 2817331Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81650] (42 PDB entries)
    Uniprot P04191
  8. 2817339Domain d3fgob2: 3fgo B:125-239 [209907]
    Other proteins in same PDB: d3fgoa1, d3fgoa3, d3fgoa4, d3fgob1, d3fgob3, d3fgob4
    automated match to d1wpga1
    complexed with acp, act, cza, k, mf4, mg, mn

Details for d3fgob2

PDB Entry: 3fgo (more details), 2.5 Å

PDB Description: Crystal Structure of the E2 magnesium fluoride complex of the (SR) Ca2+-ATPase with bound CPA and AMPPCP
PDB Compounds: (B:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

SCOPe Domain Sequences for d3fgob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fgob2 b.82.7.1 (B:125-239) Calcium ATPase, transduction domain A {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
emgkvyradrksvqrikardivpgdivevavgdkvpadirilsiksttlrvdqsiltges
vsvikhtepvpdpravnqdkknmlfsgtniaagkalgivattgvsteigkirdqm

SCOPe Domain Coordinates for d3fgob2:

Click to download the PDB-style file with coordinates for d3fgob2.
(The format of our PDB-style files is described here.)

Timeline for d3fgob2: