Lineage for d3ffdb2 (3ffd B:117-217)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2759949Domain d3ffdb2: 3ffd B:117-217 [209889]
    Other proteins in same PDB: d3ffda_
    automated match to d1jvka2

Details for d3ffdb2

PDB Entry: 3ffd (more details), 2 Å

PDB Description: Structure of parathyroid hormone-related protein complexed to a neutralizing monoclonal antibody
PDB Compounds: (B:) Monoclonal antibody, light chain, Fab fragment

SCOPe Domain Sequences for d3ffdb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ffdb2 b.1.1.0 (B:117-217) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
epkstptltvfppsseelkenkatlvclisnfspsgvtvawkangtpitqgvdtsnptke
gnkfmassflhltsdqwrshnsftcqvthegdtvekslspa

SCOPe Domain Coordinates for d3ffdb2:

Click to download the PDB-style file with coordinates for d3ffdb2.
(The format of our PDB-style files is described here.)

Timeline for d3ffdb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ffdb1
View in 3D
Domains from other chains:
(mouse over for more information)
d3ffda_