| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.40: CH domain-like [47575] (3 superfamilies) core: 4 helices: bundle |
Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) ![]() |
| Family a.40.1.0: automated matches [227151] (1 protein) not a true family |
| Protein automated matches [226856] (4 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [224978] (33 PDB entries) |
| Domain d3ferc2: 3fer C:148-261 [209885] automated match to d1sh5a2 complexed with acy |
PDB Entry: 3fer (more details), 2.4 Å
SCOPe Domain Sequences for d3ferc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ferc2 a.40.1.0 (C:148-261) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kqtpkqrllgwiqnkipylpitnfnqnwqdgkalgalvdscapglcpdweswdpqkpvdn
areamqqaddwlgvpqvitpeeiihpdvdehsvmtylsqfpkaklkpgaplkpk
Timeline for d3ferc2: