Lineage for d3ferb1 (3fer B:23-134)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1269975Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 1269976Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) (S)
  5. 1270047Family a.40.1.0: automated matches [227151] (1 protein)
    not a true family
  6. 1270048Protein automated matches [226856] (1 species)
    not a true protein
  7. 1270049Species Human (Homo sapiens) [TaxId:9606] [224978] (13 PDB entries)
  8. 1270080Domain d3ferb1: 3fer B:23-134 [209882]
    automated match to d1sh5a1
    complexed with acy

Details for d3ferb1

PDB Entry: 3fer (more details), 2.4 Å

PDB Description: Crystal structure of n-terminal actin-binding domain from human filamin b (tandem ch-domains). northeast structural genomics consortium target hr5571a.
PDB Compounds: (B:) Filamin-B

SCOPe Domain Sequences for d3ferb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ferb1 a.40.1.0 (B:23-134) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pwkkiqqntftrwcnehlkcvnkrignlqtdlsdglrliallevlsqkrmyrkyhqrptf
rqmqlenvsvalefldresiklvsidskaivdgnlklilglvwtlilhysis

SCOPe Domain Coordinates for d3ferb1:

Click to download the PDB-style file with coordinates for d3ferb1.
(The format of our PDB-style files is described here.)

Timeline for d3ferb1: