Lineage for d3ferb1 (3fer B:23-134)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712022Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 2712023Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) (S)
  5. 2712101Family a.40.1.0: automated matches [227151] (1 protein)
    not a true family
  6. 2712102Protein automated matches [226856] (4 species)
    not a true protein
  7. 2712108Species Human (Homo sapiens) [TaxId:9606] [224978] (33 PDB entries)
  8. 2712143Domain d3ferb1: 3fer B:23-134 [209882]
    automated match to d1sh5a1
    complexed with acy

Details for d3ferb1

PDB Entry: 3fer (more details), 2.4 Å

PDB Description: Crystal structure of n-terminal actin-binding domain from human filamin b (tandem ch-domains). northeast structural genomics consortium target hr5571a.
PDB Compounds: (B:) Filamin-B

SCOPe Domain Sequences for d3ferb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ferb1 a.40.1.0 (B:23-134) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pwkkiqqntftrwcnehlkcvnkrignlqtdlsdglrliallevlsqkrmyrkyhqrptf
rqmqlenvsvalefldresiklvsidskaivdgnlklilglvwtlilhysis

SCOPe Domain Coordinates for d3ferb1:

Click to download the PDB-style file with coordinates for d3ferb1.
(The format of our PDB-style files is described here.)

Timeline for d3ferb1: