Lineage for d1mfcl2 (1mfc L:112-212)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 290004Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 290069Species Mouse (Mus musculus) [TaxId:10090] [88571] (20 PDB entries)
  8. 290071Domain d1mfcl2: 1mfc L:112-212 [20988]
    Other proteins in same PDB: d1mfch1, d1mfch2, d1mfcl1
    part of Fab SE155-4
    complexed with abe, gal, man, ram

Details for d1mfcl2

PDB Entry: 1mfc (more details), 2.1 Å

PDB Description: high resolution structures of antibody fab fragment complexed with cell-surface oligosaccharide of pathogenic salmonella

SCOP Domain Sequences for d1mfcl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mfcl2 b.1.1.2 (L:112-212) Immunoglobulin light chain lambda constant domain, CL-lambda {Mouse (Mus musculus)}
pksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqs
nnkymassyltltarawerhssyscqvtheghtvekslsra

SCOP Domain Coordinates for d1mfcl2:

Click to download the PDB-style file with coordinates for d1mfcl2.
(The format of our PDB-style files is described here.)

Timeline for d1mfcl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mfcl1