Lineage for d3fe1c2 (3fe1 C:191-384)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1857401Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1858517Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1858518Protein automated matches [226839] (49 species)
    not a true protein
  7. 1858644Species Human (Homo sapiens) [TaxId:9606] [224896] (42 PDB entries)
  8. 1858682Domain d3fe1c2: 3fe1 C:191-384 [209875]
    automated match to d1ngfa2
    complexed with adp, cl, mg, pge, po4

Details for d3fe1c2

PDB Entry: 3fe1 (more details), 2.2 Å

PDB Description: Crystal structure of the human 70kDa heat shock protein 6 (Hsp70B') ATPase domain in complex with ADP and inorganic phosphate
PDB Compounds: (C:) Heat shock 70 kDa protein 6

SCOPe Domain Sequences for d3fe1c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fe1c2 c.55.1.0 (C:191-384) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gagernvlifdlgggtfdvsvlsidagvfevkatagdthlggedfdnrlvnhfmeefrrk
hgkdlsgnkralrrlrtacerakrtlssstqatleidslfegvdfytsitrarfeelcsd
lfrstlepvekalrdakldkaqihdvvlvggstripkvqkllqdffngkelnksinpdea
vaygaavqaavlmg

SCOPe Domain Coordinates for d3fe1c2:

Click to download the PDB-style file with coordinates for d3fe1c2.
(The format of our PDB-style files is described here.)

Timeline for d3fe1c2: