Lineage for d3fdue_ (3fdu E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853595Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2853596Protein automated matches [190246] (71 species)
    not a true protein
  7. 2853597Species Acinetobacter baumannii [TaxId:400667] [225573] (1 PDB entry)
  8. 2853602Domain d3fdue_: 3fdu E: [209868]
    Other proteins in same PDB: d3fdua2, d3fdub2, d3fduc2, d3fdud2
    automated match to d3peaf_
    complexed with gol, so4

Details for d3fdue_

PDB Entry: 3fdu (more details), 2 Å

PDB Description: crystal structure of a putative enoyl-coa hydratase/isomerase from acinetobacter baumannii
PDB Compounds: (E:) Putative enoyl-CoA hydratase/isomerase

SCOPe Domain Sequences for d3fdue_:

Sequence, based on SEQRES records: (download)

>d3fdue_ c.14.1.0 (E:) automated matches {Acinetobacter baumannii [TaxId: 400667]}
hlnanleggvltlainrpeaknalygelylwiakaldeadqnkdvrvvvlrgaehdftag
ndmkdfmgfvqnpnagpagqvppfvllksaarlskpliiavkgvaigigvtillqadlvf
adntalfqipfvslglspeggasqllvkqagyhkaaellftakkfnaetalqaglvneiv
edayataqataqhltalplaslkqtkalmkhdldqiiecidheaeifmqrvqspemlea

Sequence, based on observed residues (ATOM records): (download)

>d3fdue_ c.14.1.0 (E:) automated matches {Acinetobacter baumannii [TaxId: 400667]}
hlnanleggvltlainrpeaknalygelylwiakaldeadqnkdvrvvvlrgaehdftag
ndmkdfmgfvqpagqvppfvllksaarlskpliiavkgvaigigvtillqadlvfadnta
lfqipfvslglspeggasqllvkqagyhkaaellftakkfnaetalqaglvneivedaya
taqataqhltalplaslkqtkalmkhdldqiiecidheaeifmqrvqspemlea

SCOPe Domain Coordinates for d3fdue_:

Click to download the PDB-style file with coordinates for d3fdue_.
(The format of our PDB-style files is described here.)

Timeline for d3fdue_: