Lineage for d3fdud1 (3fdu D:10-242)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2100042Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2100043Protein automated matches [190246] (54 species)
    not a true protein
  7. 2100044Species Acinetobacter baumannii [TaxId:400667] [225573] (1 PDB entry)
  8. 2100048Domain d3fdud1: 3fdu D:10-242 [209867]
    Other proteins in same PDB: d3fdua2, d3fdub2, d3fduc2, d3fdud2
    automated match to d3peaf_
    complexed with gol, so4

Details for d3fdud1

PDB Entry: 3fdu (more details), 2 Å

PDB Description: crystal structure of a putative enoyl-coa hydratase/isomerase from acinetobacter baumannii
PDB Compounds: (D:) Putative enoyl-CoA hydratase/isomerase

SCOPe Domain Sequences for d3fdud1:

Sequence, based on SEQRES records: (download)

>d3fdud1 c.14.1.0 (D:10-242) automated matches {Acinetobacter baumannii [TaxId: 400667]}
hphlnanleggvltlainrpeaknalygelylwiakaldeadqnkdvrvvvlrgaehdft
agndmkdfmgfvqnpnagpagqvppfvllksaarlskpliiavkgvaigigvtillqadl
vfadntalfqipfvslglspeggasqllvkqagyhkaaellftakkfnaetalqaglvne
ivedayataqataqhltalplaslkqtkalmkhdldqiiecidheaeifmqrv

Sequence, based on observed residues (ATOM records): (download)

>d3fdud1 c.14.1.0 (D:10-242) automated matches {Acinetobacter baumannii [TaxId: 400667]}
hphlnanleggvltlainrpeaknalygelylwiakaldeadqnkdvrvvvlrgaehdft
agndmkdfgpagqvppfvllksaarlskpliiavkgvaigigvtillqadlvfadntalf
qipfvslglspeggasqllvkqagyhkaaellftakkfnaetalqaglvneivedayata
qataqhltalplaslkqtkalmkhdldqiiecidheaeifmqrv

SCOPe Domain Coordinates for d3fdud1:

Click to download the PDB-style file with coordinates for d3fdud1.
(The format of our PDB-style files is described here.)

Timeline for d3fdud1: