SCOPe 2.07: Domain d3fdsa1: 3fds A:1-240

Lineage for d3fdsa1 (3fds A:1-240)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (5 proteins)
   contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2)

6. Protein DinB homolog (DBH) [100889] (3 species)

7. Species Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100890] (41 PDB entries)

8. Domain d3fdsa1: 3fds A:1-240 [209860]
   Other proteins in same PDB: d3fdsa2, d3fdsd1, d3fdsd2
   automated match to d1n48a2
   protein/DNA complex; complexed with 1pe, edo, gol, peg, pge

Details for d3fdsa1

PDB Entry: 3fds, 2.05 Å

PDB Description: structural insight into recruitment of translesion dna polymerase dpo4 to sliding clamp pcna

PDB Compounds: (A:) DNA polymerase IV

SCOPe Domain Sequences for d3fdsa1:

Sequence; same for both SEQRES and ATOM records:

>d3fdsa1 e.8.1.7 (A:1-240) DinB homolog (DBH) {Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]}
mivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfgvkagip
iveakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdkvrdyre
aynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrlireldi
advpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeynepirtr

Timeline for d3fdsa1:

• d3fdsa1 first appeared in SCOPe 2.03
  
• d3fdsa1 appears in SCOPe 2.06
  
• d3fdsa1 appears in the current release, SCOPe 2.08