![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88571] (21 PDB entries) Uniprot Q8N355 20-230 # 94% sequence identity; natural chimera: antibody light chain (Fab HYB3) |
![]() | Domain d1mfel2: 1mfe L:112-211 [20986] Other proteins in same PDB: d1mfeh1, d1mfeh2, d1mfel1 part of Fab SE155-4 |
PDB Entry: 1mfe (more details), 2 Å
SCOPe Domain Sequences for d1mfel2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mfel2 b.1.1.2 (L:112-211) Immunoglobulin light chain lambda constant domain, CL-lambda {Mouse (Mus musculus) [TaxId: 10090]} pksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqs nnkymassyltltarawerhssyscqvtheghtvekslsr
Timeline for d1mfel2: