SCOPe 2.08: Domain d3fcpf1: 3fcp F:5-131

Lineage for d3fcpf1 (3fcp F:5-131)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (95 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:272620] [225571] (1 PDB entry)

8. Domain d3fcpf1: 3fcp F:5-131 [209854]
   Other proteins in same PDB: d3fcpa2, d3fcpa3, d3fcpb2, d3fcpc2, d3fcpd2, d3fcpe2, d3fcpf2, d3fcpg2, d3fcph2, d3fcph3
   automated match to d1f9ca2
   complexed with mg

Details for d3fcpf1

PDB Entry: 3fcp, 1.8 Å

PDB Description: crystal structure of muconate lactonizing enzyme from klebsiella pneumoniae

PDB Compounds: (F:) L-Ala-D/L-Glu epimerase, a muconate lactonizing enzyme

SCOPe Domain Sequences for d3fcpf1:

Sequence, based on SEQRES records:

>d3fcpf1 d.54.1.0 (F:5-131) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
atveqieswivdvptirphklsmttmgcqslvivrltrsdgicgigeattigglsygves
peaissaithyltpllkgqpadnlnaltarmngaikgntfaksaietalldaqgkalglp
vsallgg

Sequence, based on observed residues (ATOM records):

>d3fcpf1 d.54.1.0 (F:5-131) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
atveqieswivdvpticqslvivrltrsdgicgigeattigglsygvespeaissaithy
ltpllkgqpadnlnaltarmngaikgntfaksaietalldaqgkalglpvsallgg

Timeline for d3fcpf1:

• d3fcpf1 first appeared in SCOPe 2.03
  
• d3fcpf1 appears in SCOPe 2.07