Lineage for d3fcpa2 (3fcp A:132-373)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1343755Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1344084Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 1344085Protein automated matches [226923] (45 species)
    not a true protein
  7. 1344202Species Klebsiella pneumoniae [TaxId:272620] [225572] (1 PDB entry)
  8. 1344203Domain d3fcpa2: 3fcp A:132-373 [209845]
    Other proteins in same PDB: d3fcpa1, d3fcpb1, d3fcpc1, d3fcpd1, d3fcpe1, d3fcpf1, d3fcpg1, d3fcph1
    automated match to d1f9ca1
    complexed with mg

Details for d3fcpa2

PDB Entry: 3fcp (more details), 1.8 Å

PDB Description: crystal structure of muconate lactonizing enzyme from klebsiella pneumoniae
PDB Compounds: (A:) L-Ala-D/L-Glu epimerase, a muconate lactonizing enzyme

SCOPe Domain Sequences for d3fcpa2:

Sequence, based on SEQRES records: (download)

>d3fcpa2 c.1.11.0 (A:132-373) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
alqtalpvlwtlasgdtakdiaegekllaegrhrafklkigarelatdlrhtraivealg
drasirvdvnqawdaatgakgcrelaamgvdlieqpvsahdnaalvrlsqqietailade
avataydgyqlaqqgftgayalkiakaggpnsvlalarvaqaagiglyggtmlegtvgtv
aslhawstlplqwgtemfgplllkddivsvpltfadgqvalpqtpglgveldedklhfyt
rq

Sequence, based on observed residues (ATOM records): (download)

>d3fcpa2 c.1.11.0 (A:132-373) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
alqtalpvlwtlasgdtakdiaegekllarafklkigarelatdlrhtraivealgdras
irvdvnqawdaatgakgcrelaamgvdlieqpvsahdnaalvrlsqqietailadeavat
aydgyqlaqqgftgayalkiakaggpnsvlalarvaqaagiglyggtmlegtvgtvaslh
awstlplqwgtemfgplllkddivsvpltfadgqvalpqtpglgveldedklhfytrq

SCOPe Domain Coordinates for d3fcpa2:

Click to download the PDB-style file with coordinates for d3fcpa2.
(The format of our PDB-style files is described here.)

Timeline for d3fcpa2: