Lineage for d3fc4a4 (3fc4 A:311-907)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2540508Fold d.133: Molybdenum cofactor-binding domain [56002] (1 superfamily)
    beta(2)-alpha-beta-alpha-beta; 2 layers: a/b; mixed sheet: order 1243: crossing loops
  4. 2540509Superfamily d.133.1: Molybdenum cofactor-binding domain [56003] (2 families) (S)
    duplication: consists of 4 structural repeats arranged in 2 lobes
    contains one left-hand beta-alpha-beta unit per lobe
    automatically mapped to Pfam PF02738
  5. 2540510Family d.133.1.1: Molybdenum cofactor-binding domain [56004] (7 proteins)
  6. 2540517Protein Aldehyde oxidoreductase [56005] (2 species)
  7. 2540520Species Desulfovibrio gigas [TaxId:879] [56006] (12 PDB entries)
    Uniprot Q46509
  8. 2540529Domain d3fc4a4: 3fc4 A:311-907 [209843]
    Other proteins in same PDB: d3fc4a1, d3fc4a2, d3fc4a3
    automated match to d1vlba4
    complexed with cl, edo, fes, mg, pcd

Details for d3fc4a4

PDB Entry: 3fc4 (more details), 1.79 Å

PDB Description: Ethylene glycol inhibited form of Aldehyde oxidoreductase from Desulfovibrio gigas
PDB Compounds: (A:) aldehyde oxidoreductase

SCOPe Domain Sequences for d3fc4a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fc4a4 d.133.1.1 (A:311-907) Aldehyde oxidoreductase {Desulfovibrio gigas [TaxId: 879]}
msgpaaaaedaieihpgtpnvyfeqpivkgedtgpifasadvtvegdfyvgrqphmpiep
dvafaymgddgkcyihsksigvhlhlymiapgvglepdqlvlvanpmggtfgykfsptse
alvavaamatgrpvhlrynyqqqqqytgkrspwemnvkfaakkdgtllamesdwlvdhgp
ysefgdlltlrgaqfigagynipnirglgrtvatnhvwgsafrgygapqsmfaseclmdm
laeklgmdplelryknayrpgdtnptgqepevfslpdmidqlrpkyqaalekaqkestat
hkkgvgisigvygsgldgpdaseawaelnadgtitvhtawedhgqgadigcvgtahealr
pmgvapekikftwpntattpnsgpsggsrqqvmtgnairvacenllkacekpgggyytyd
elkaadkptkitgnwtasgathcdavtglgkpfvvymygvfmaevtvdvatgqttvdgmt
lmadlgslcnqlatdgqiygglaqgiglalsedfedikkhatlvgagfpfikqipdkldi
vyvnhprpdgpfgasgvgelpltsphaaiinaiksatgvriyrlpaypekvlealka

SCOPe Domain Coordinates for d3fc4a4:

Click to download the PDB-style file with coordinates for d3fc4a4.
(The format of our PDB-style files is described here.)

Timeline for d3fc4a4: