SCOPe 2.04: Domain d3fc4a3: 3fc4 A:194-310

Lineage for d3fc4a3 (3fc4 A:194-310)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families)

5. Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (6 proteins)

6. Protein Aldehyde oxidoreductase, domain 3 [54667] (2 species)

7. Species Desulfovibrio gigas [TaxId:879] [54668] (11 PDB entries)
   Uniprot Q46509

8. Domain d3fc4a3: 3fc4 A:194-310 [209842]
   Other proteins in same PDB: d3fc4a1, d3fc4a2, d3fc4a4
   automated match to d1vlba3
   complexed with cl, edo, fes, mg, pcd

Details for d3fc4a3

PDB Entry: 3fc4, 1.79 Å

PDB Description: Ethylene glycol inhibited form of Aldehyde oxidoreductase from Desulfovibrio gigas

PDB Compounds: (A:) aldehyde oxidoreductase

SCOPe Domain Sequences for d3fc4a3:

Sequence; same for both SEQRES and ATOM records:

>d3fc4a3 d.41.1.1 (A:194-310) Aldehyde oxidoreductase, domain 3 {Desulfovibrio gigas [TaxId: 879]}
dygadlglkmpagtlhlamvqakvshanikgidtsealtmpgvhsvithkdvkgknritg
litfptnkgdgwdrpilcdekvfqygdcialvcadseanaraaaekvkvdleelpay

Timeline for d3fc4a3:

• d3fc4a3 first appeared in SCOPe 2.03
  
• d3fc4a3 appears in SCOPe 2.05
  
• d3fc4a3 appears in the current release, SCOPe 2.08