Lineage for d3fc4a2 (3fc4 A:81-193)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715250Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 2715251Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) (S)
    contains 2Fe-2S cluster
  5. 2715252Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 proteins)
  6. 2715259Protein Aldehyde oxidoreductase, domain 2 [47743] (2 species)
  7. 2715262Species Desulfovibrio gigas [TaxId:879] [47744] (12 PDB entries)
    Uniprot Q46509
  8. 2715267Domain d3fc4a2: 3fc4 A:81-193 [209841]
    Other proteins in same PDB: d3fc4a1, d3fc4a3, d3fc4a4
    automated match to d1vlba1
    complexed with cl, edo, fes, mg, pcd

Details for d3fc4a2

PDB Entry: 3fc4 (more details), 1.79 Å

PDB Description: Ethylene glycol inhibited form of Aldehyde oxidoreductase from Desulfovibrio gigas
PDB Compounds: (A:) aldehyde oxidoreductase

SCOPe Domain Sequences for d3fc4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fc4a2 a.56.1.1 (A:81-193) Aldehyde oxidoreductase, domain 2 {Desulfovibrio gigas [TaxId: 879]}
qpenlhplqkawvlhggaqcgfcspgfivsakglldtnadpsredvrdwfqkhrnacrct
gykplvdavmdaaavingkkpetdlefkmpadgriwgskyprptavakvtgtl

SCOPe Domain Coordinates for d3fc4a2:

Click to download the PDB-style file with coordinates for d3fc4a2.
(The format of our PDB-style files is described here.)

Timeline for d3fc4a2: