![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily) core: 4 helices, bundle |
![]() | Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) ![]() contains 2Fe-2S cluster |
![]() | Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 proteins) |
![]() | Protein Aldehyde oxidoreductase, domain 2 [47743] (2 species) |
![]() | Species Desulfovibrio gigas [TaxId:879] [47744] (12 PDB entries) Uniprot Q46509 |
![]() | Domain d3fc4a2: 3fc4 A:81-193 [209841] Other proteins in same PDB: d3fc4a1, d3fc4a3, d3fc4a4 automated match to d1vlba1 complexed with cl, edo, fes, mg, pcd |
PDB Entry: 3fc4 (more details), 1.79 Å
SCOPe Domain Sequences for d3fc4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fc4a2 a.56.1.1 (A:81-193) Aldehyde oxidoreductase, domain 2 {Desulfovibrio gigas [TaxId: 879]} qpenlhplqkawvlhggaqcgfcspgfivsakglldtnadpsredvrdwfqkhrnacrct gykplvdavmdaaavingkkpetdlefkmpadgriwgskyprptavakvtgtl
Timeline for d3fc4a2: