SCOPe 2.07: Domain d3fc4a1: 3fc4 A:1-80

Lineage for d3fc4a1 (3fc4 A:1-80)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)

6. Protein Aldehyde oxidoreductase, N-terminal domain [54315] (2 species)

7. Species Desulfovibrio gigas [TaxId:879] [54316] (12 PDB entries)
   Uniprot Q46509

8. Domain d3fc4a1: 3fc4 A:1-80 [209840]
   Other proteins in same PDB: d3fc4a2, d3fc4a3, d3fc4a4
   automated match to d1vlba2
   complexed with cl, edo, fes, mg, pcd

Details for d3fc4a1

PDB Entry: 3fc4, 1.79 Å

PDB Description: Ethylene glycol inhibited form of Aldehyde oxidoreductase from Desulfovibrio gigas

PDB Compounds: (A:) aldehyde oxidoreductase

SCOPe Domain Sequences for d3fc4a1:

Sequence; same for both SEQRES and ATOM records:

>d3fc4a1 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio gigas [TaxId: 879]}
miqkvitvngieqnlfvdaeallsdvlrqqlgltgvkvgceqgqcgacsvildgkvvrac
vtkmkrvadgaqittiegvg

Timeline for d3fc4a1:

• d3fc4a1 first appeared in SCOPe 2.03
  
• d3fc4a1 appears in SCOPe 2.06
  
• d3fc4a1 appears in the current release, SCOPe 2.08