Lineage for d3fc4a1 (3fc4 A:1-80)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2540890Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2541095Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
  6. 2541102Protein Aldehyde oxidoreductase, N-terminal domain [54315] (2 species)
  7. 2541105Species Desulfovibrio gigas [TaxId:879] [54316] (12 PDB entries)
    Uniprot Q46509
  8. 2541114Domain d3fc4a1: 3fc4 A:1-80 [209840]
    Other proteins in same PDB: d3fc4a2, d3fc4a3, d3fc4a4
    automated match to d1vlba2
    complexed with cl, edo, fes, mg, pcd

Details for d3fc4a1

PDB Entry: 3fc4 (more details), 1.79 Å

PDB Description: Ethylene glycol inhibited form of Aldehyde oxidoreductase from Desulfovibrio gigas
PDB Compounds: (A:) aldehyde oxidoreductase

SCOPe Domain Sequences for d3fc4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fc4a1 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio gigas [TaxId: 879]}
miqkvitvngieqnlfvdaeallsdvlrqqlgltgvkvgceqgqcgacsvildgkvvrac
vtkmkrvadgaqittiegvg

SCOPe Domain Coordinates for d3fc4a1:

Click to download the PDB-style file with coordinates for d3fc4a1.
(The format of our PDB-style files is described here.)

Timeline for d3fc4a1: